PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do011628.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family bZIP
Protein Properties Length: 571aa    MW: 62184.9 Da    PI: 6.5142
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do011628.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1377.6e-12229282457
                 XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                  k+ rr   NRe+ArrsR+R++  + +Le  v  L+ eN +L k+l+ ++++++
  Do011628.1 229 AKKMRRTLLNRESARRSRKRRQTHMCNLESQVSRLTYENASLLKRLDDMTQKYK 282
                 7999***************************************99988888876 PP

2bZIP_146.76.9e-15378432357
                 XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                 + k+ rr+ +NRe+ArrsR+RK+a +  Le  v  L++ N++L k+l  ++++++
  Do011628.1 378 STKKLRRMLSNRESARRSRKRKQAHLTDLESQVSRLTSDNESLLKRLADMTQKYK 432
                 6799*************************************99966666666555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.5E-10223282No hitNo description
SMARTSM003382.8E-8226290IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.519228280IPR004827Basic-leucine zipper domain
PfamPF001702.0E-11228282IPR004827Basic-leucine zipper domain
SuperFamilySSF579597.47E-10230281No hitNo description
CDDcd147021.91E-14231281No hitNo description
SMARTSM003387.8E-18376440IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.208378430IPR004827Basic-leucine zipper domain
PfamPF001701.0E-12378432IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.04E-11380431No hitNo description
Gene3DG3DSA:1.20.5.1702.0E-12380432No hitNo description
CDDcd147024.56E-18381431No hitNo description
PROSITE patternPS000360383398IPR004827Basic-leucine zipper domain
PfamPF124982.2E-23447552IPR020983Basic leucine-zipper, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 571 aa     Download sequence    Send to blast
LVVRKCNSTN TFIPTARTTH AGLIVCARCQ LAATITATGI NVLPAVFTLH HCSGCSQLPS  60
SSTSSGTGCE ERKRLSSSNM ADGVDDEVWE LSCGGGRGDP GADDAAELRR KLDLYCAAVA  120
KSMTPELKPG VLAAAIHRRF CFCDAYVSPF QEAKSQESSL GYSNPQPSGT SELISQASFD  180
GYGDGASLVT NPNFIGHDDF RGNVVNSGTS KEQSNDGGNL EEQTDPENAK KMRRTLLNRE  240
SARRSRKRRQ THMCNLESQV SRLTYENASL LKRLDDMTQK YKDATLHSRN LTVDVETMRK  300
KEAKSQESSL GYTNSQASDT SQLISQASFD GDGDGANLVT NSNIIDHDNF QGKPANSGTS  360
KEQSDDDGDL EVNTDPASTK KLRRMLSNRE SARRSRKRKQ AHLTDLESQV SRLTSDNESL  420
LKRLADMTQK YKDATLDNRN LTVDVETMRR KVNIAEEAVR RLTGTTLLLS TTSDKPASIT  480
RLTSCASDAA SASVAVDNSM EHFLQAPLQD DQIMLDLPNA AIPLNSGEIG TKPASLRRVA  540
SLEDLQKRIH GDSLHSETAS TFSDPEAFAD R
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1244249SRKRRQ
2392398RRSRKRK
3392399RRSRKRKQ
4394399SRKRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004963102.21e-139PREDICTED: light-inducible protein CPRF2-like isoform X2
TrEMBLC5YRE41e-139C5YRE4_SORBI; Putative uncharacterized protein Sb08g020600
TrEMBLK3Z7111e-138K3Z711_SETIT; Uncharacterized protein
STRINGSi022331m1e-138(Setaria italica)
STRINGSb08g020600.11e-139(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP75952943
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24800.14e-25basic leucine zipper 9